| Name | INPP5B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2472 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | INPP5B antibody was raised using the middle region of INPP5B corresponding to a region with amino acids IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN |
| Purity/Format | Affinity purified |
| Blocking Peptide | INPP5B Blocking Peptide |
| Description | Rabbit polyclonal INPP5B antibody raised against the middle region of INPP5B |
| Gene | INPP5B |
| Supplier Page | Shop |