| Name | GPR161 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7067 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | GPR161 antibody was raised using the middle region of GPR161 corresponding to a region with amino acids FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG |
| Purity/Format | Affinity purified |
| Blocking Peptide | GPR161 Blocking Peptide |
| Description | Rabbit polyclonal GPR161 antibody raised against the middle region of GPR161 |
| Gene | GPR161 |
| Supplier Page | Shop |