LANCL2 antibody

Name LANCL2 antibody
Supplier Fitzgerald
Catalog 70R-2665
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK
Purity/Format Affinity purified
Blocking Peptide LANCL2 Blocking Peptide
Description Rabbit polyclonal LANCL2 antibody
Gene HTRA3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.