TIA1 antibody

Name TIA1 antibody
Supplier Fitzgerald
Catalog 70R-5035
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen TIA1 antibody was raised using the N terminal of TIA1 corresponding to a region with amino acids MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED
Purity/Format Affinity purified
Blocking Peptide TIA1 Blocking Peptide
Description Rabbit polyclonal TIA1 antibody raised against the N terminal of TIA1
Gene TIA1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.