| Name | PCDHA6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6169 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | PCDHA6 antibody was raised using the C terminal of PCDHA6 corresponding to a region with amino acids LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCDHA6 Blocking Peptide |
| Description | Rabbit polyclonal PCDHA6 antibody raised against the C terminal of PCDHA6 |
| Gene | CNR2 |
| Supplier Page | Shop |