PLDN antibody

Name PLDN antibody
Supplier Fitzgerald
Catalog 70R-2857
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE
Purity/Format Affinity purified
Blocking Peptide PLDN Blocking Peptide
Description Rabbit polyclonal PLDN antibody
Gene BLOC1S6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.