| Name | NR2E1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5228 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NR2E1 antibody was raised using the middle region of NR2E1 corresponding to a region with amino acids LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | NR2E1 Blocking Peptide |
| Description | Rabbit polyclonal NR2E1 antibody raised against the middle region of NR2E1 |
| Gene | NR2E1 |
| Supplier Page | Shop |