| Name | KHSRP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4811 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG |
| Purity/Format | Affinity purified |
| Blocking Peptide | KHSRP Blocking Peptide |
| Description | Rabbit polyclonal KHSRP antibody raised against the middle region of KHSRP |
| Gene | KHSRP |
| Supplier Page | Shop |