| Name | PPID antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4331 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PPID antibody was raised using a synthetic peptide corresponding to a region with amino acids CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPID Blocking Peptide |
| Description | Rabbit polyclonal PPID antibody |
| Gene | PPID |
| Supplier Page | Shop |