| Name | PERP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7291 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PERP antibody was raised using the middle region of PERP corresponding to a region with amino acids FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG |
| Purity/Format | Affinity purified |
| Blocking Peptide | PERP Blocking Peptide |
| Description | Rabbit polyclonal PERP antibody raised against the middle region of PERP |
| Gene | PERP |
| Supplier Page | Shop |