| Name | Influenza Virus Ns1A Binding Protein antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2152 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK |
| Purity/Format | Affinity purified |
| Blocking Peptide | Influenza Virus Ns1A Binding Protein Blocking Peptide |
| Description | Rabbit polyclonal Influenza Virus Ns1A Binding Protein antibody raised against the N terminal of IVNS1ABP |
| Gene | IVNS1ABP |
| Supplier Page | Shop |