| Name | FTO antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4523 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA |
| Purity/Format | Affinity purified |
| Blocking Peptide | FTO Blocking Peptide |
| Description | Rabbit polyclonal FTO antibody raised against the middle region of FTO |
| Gene | FTO |
| Supplier Page | Shop |