| Name | PSME3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2344 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PSME3 antibody was raised using the N terminal of PSME3 corresponding to a region with amino acids PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | PSME3 Blocking Peptide |
| Description | Rabbit polyclonal PSME3 antibody raised against the N terminal of PSME3 |
| Gene | PSME3 |
| Supplier Page | Shop |