| Name | EXOSC7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4747 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC |
| Purity/Format | Affinity purified |
| Blocking Peptide | EXOSC7 Blocking Peptide |
| Description | Rabbit polyclonal EXOSC7 antibody raised against the N terminal of EXOSC7 |
| Gene | EXOSC7 |
| Supplier Page | Shop |