ZDHHC17 antibody

Name ZDHHC17 antibody
Supplier Fitzgerald
Catalog 70R-1832
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
Purity/Format Total IgG Protein A purified
Blocking Peptide ZDHHC17 Blocking Peptide
Description Rabbit polyclonal ZDHHC17 antibody raised against the middle region of ZDHHC17
Gene ZDHHC17
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.