Name | CSK antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3659 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CSK antibody was raised using the middle region of CSK corresponding to a region with amino acids SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF |
Purity/Format | Affinity purified |
Blocking Peptide | CSK Blocking Peptide |
Description | Rabbit polyclonal CSK antibody raised against the middle region of CSK |
Gene | CSK |
Supplier Page | Shop |