CSK antibody

Name CSK antibody
Supplier Fitzgerald
Catalog 70R-3659
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CSK antibody was raised using the middle region of CSK corresponding to a region with amino acids SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF
Purity/Format Affinity purified
Blocking Peptide CSK Blocking Peptide
Description Rabbit polyclonal CSK antibody raised against the middle region of CSK
Gene CSK
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.