DNASE2B antibody

Name DNASE2B antibody
Supplier Fitzgerald
Catalog 70R-7163
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DNASE2B antibody was raised using the middle region of DNASE2B corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
Purity/Format Affinity purified
Blocking Peptide DNASE2B Blocking Peptide
Description Rabbit polyclonal DNASE2B antibody raised against the middle region of DNASE2B
Gene DNASE2B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.