PTPRR antibody

Name PTPRR antibody
Supplier Fitzgerald
Catalog 70R-6617
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PTPRR antibody was raised using the N terminal of PTPRR corresponding to a region with amino acids NIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIP
Purity/Format Affinity purified
Blocking Peptide PTPRR Blocking Peptide
Description Rabbit polyclonal PTPRR antibody raised against the N terminal of PTPRR
Gene PTPRR
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.