| Name | KCNJ8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5131 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KCNJ8 antibody was raised using the middle region of KCNJ8 corresponding to a region with amino acids EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNJ8 Blocking Peptide |
| Description | Rabbit polyclonal KCNJ8 antibody raised against the middle region of KCNJ8 |
| Gene | KCNJ8 |
| Supplier Page | Shop |