Ectodysplasin A Receptor antibody

Name Ectodysplasin A Receptor antibody
Supplier Fitzgerald
Catalog 70R-7548
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Ectodysplasin A Receptor antibody was raised using the middle region of EDAR corresponding to a region with amino acids PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV
Purity/Format Affinity purified
Blocking Peptide Ectodysplasin A Receptor Blocking Peptide
Description Rabbit polyclonal Ectodysplasin A Receptor antibody raised against the middle region of EDAR
Gene EDAR
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.