| Name | AHCYL1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3883 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE |
| Purity/Format | Affinity purified |
| Blocking Peptide | AHCYL1 Blocking Peptide |
| Description | Rabbit polyclonal AHCYL1 antibody raised against the N terminal of AHCYL1 |
| Gene | AHCYL1 |
| Supplier Page | Shop |