FBXO5 antibody

Name FBXO5 antibody
Supplier Fitzgerald
Catalog 70R-2793
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL
Purity/Format Affinity purified
Blocking Peptide FBXO5 Blocking Peptide
Description Rabbit polyclonal FBXO5 antibody raised against the C terminal of FBXO5
Gene FBXO5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.