| Name | CPSF4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4619 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | CPSF4 antibody was raised using the C terminal of CPSF4 corresponding to a region with amino acids SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK |
| Purity/Format | Affinity purified |
| Blocking Peptide | CPSF4 Blocking Peptide |
| Description | Rabbit polyclonal CPSF4 antibody raised against the C terminal of CPSF4 |
| Gene | CPSF4 |
| Supplier Page | Shop |