| Name | CLEC4M antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1704 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | CLEC4M antibody was raised using the N terminal of CLEC4M corresponding to a region with amino acids LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CLEC4M Blocking Peptide |
| Description | Rabbit polyclonal CLEC4M antibody raised against the N terminal of CLEC4M |
| Gene | CLEC4M |
| Supplier Page | Shop |