| Name | HNRPK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4651 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | HNRPK antibody was raised using the N terminal of HNRPK corresponding to a region with amino acids NTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKG |
| Purity/Format | Affinity purified |
| Blocking Peptide | HNRPK Blocking Peptide |
| Description | Rabbit polyclonal HNRPK antibody raised against the N terminal of HNRPK |
| Gene | HNRNPK |
| Supplier Page | Shop |