| Name | P4HB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5394 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | P4HB antibody was raised using the C terminal of P4HB corresponding to a region with amino acids DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD |
| Purity/Format | Affinity purified |
| Blocking Peptide | P4HB Blocking Peptide |
| Description | Rabbit polyclonal P4HB antibody raised against the C terminal of P4HB |
| Gene | P4HB |
| Supplier Page | Shop |