| Name | WDR51B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3215 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | WDR51B antibody was raised using the N terminal of WDR51B corresponding to a region with amino acids GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS |
| Purity/Format | Affinity purified |
| Blocking Peptide | WDR51B Blocking Peptide |
| Description | Rabbit polyclonal WDR51B antibody raised against the N terminal of WDR51B |
| Gene | POC1B |
| Supplier Page | Shop |