| Name | HMBS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3343 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA |
| Purity/Format | Affinity purified |
| Blocking Peptide | HMBS Blocking Peptide |
| Description | Rabbit polyclonal HMBS antibody raised against the N terminal of HMBS |
| Gene | HMBS |
| Supplier Page | Shop |