Name | OLFM4 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1580 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | OLFM4 Blocking Peptide |
Description | Rabbit polyclonal OLFM4 antibody raised against the C terminal of OLFM4 |
Gene | OLFM4 |
Supplier Page | Shop |