| Name | OLFM4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1580 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | OLFM4 Blocking Peptide |
| Description | Rabbit polyclonal OLFM4 antibody raised against the C terminal of OLFM4 |
| Gene | OLFM4 |
| Supplier Page | Shop |