| Name | TOLLIP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5778 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TOLLIP antibody was raised using the C terminal of TOLLIP corresponding to a region with amino acids MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG |
| Purity/Format | Affinity purified |
| Blocking Peptide | TOLLIP Blocking Peptide |
| Description | Rabbit polyclonal TOLLIP antibody raised against the C terminal of TOLLIP |
| Gene | TOLLIP |
| Supplier Page | Shop |