| Name | STEAP4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6910 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | STEAP4 antibody was raised using the C terminal of STEAP4 corresponding to a region with amino acids AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA |
| Purity/Format | Affinity purified |
| Blocking Peptide | STEAP4 Blocking Peptide |
| Description | Rabbit polyclonal STEAP4 antibody raised against the C terminal of STEAP4 |
| Gene | STEAP4 |
| Supplier Page | Shop |