| Name | BVES antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6558 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS |
| Purity/Format | Affinity purified |
| Blocking Peptide | BVES Blocking Peptide |
| Description | Rabbit polyclonal BVES antibody raised against the middle region of BVES |
| Gene | BVES |
| Supplier Page | Shop |