Name | BVES antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6558 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS |
Purity/Format | Affinity purified |
Blocking Peptide | BVES Blocking Peptide |
Description | Rabbit polyclonal BVES antibody raised against the middle region of BVES |
Gene | BVES |
Supplier Page | Shop |