SET antibody

Name SET antibody
Supplier Fitzgerald
Catalog 70R-5618
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Purity/Format Affinity purified
Blocking Peptide SET Blocking Peptide
Description Rabbit polyclonal SET antibody raised against the N terminal of SET
Gene SET
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.