| Name | HEPACAM antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6943 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT |
| Purity/Format | Affinity purified |
| Blocking Peptide | HEPACAM Blocking Peptide |
| Description | Rabbit polyclonal HEPACAM antibody raised against the N terminal of HEPACAM |
| Gene | HEPACAM |
| Supplier Page | Shop |