| Name | SF3B4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4853 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | SF3B4 antibody was raised using the N terminal of SF3B4 corresponding to a region with amino acids SFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP |
| Purity/Format | Affinity purified |
| Blocking Peptide | SF3B4 Blocking Peptide |
| Description | Rabbit polyclonal SF3B4 antibody raised against the N terminal of SF3B4 |
| Gene | SF3B4 |
| Supplier Page | Shop |