CACNB4 antibody

Name CACNB4 antibody
Supplier Fitzgerald
Catalog 70R-5045
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
Purity/Format Affinity purified
Blocking Peptide CACNB4 Blocking Peptide
Description Rabbit polyclonal CACNB4 antibody raised against the C terminal of CACNB4
Gene CACNB4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.