| Name | TMEM30A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6371 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | TMEM30A antibody was raised using the N terminal of TMEM30A corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMEM30A Blocking Peptide |
| Description | Rabbit polyclonal TMEM30A antibody raised against the N terminal of TMEM30A |
| Gene | TMEM30A |
| Supplier Page | Shop |