| Name | EWSR1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5013 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | EWSR1 Blocking Peptide |
| Description | Rabbit polyclonal EWSR1 antibody raised against the N terminal of EWSR1 |
| Gene | EWSR1 |
| Supplier Page | Shop |