| Name | FBXW8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3252 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FBXW8 antibody was raised using the middle region of FBXW8 corresponding to a region with amino acids MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR |
| Purity/Format | Affinity purified |
| Blocking Peptide | FBXW8 Blocking Peptide |
| Description | Rabbit polyclonal FBXW8 antibody raised against the middle region of FBXW8 |
| Gene | FBXW8 |
| Supplier Page | Shop |