Name | SLA/LP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4725 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | SLA/LP antibody was raised using the N terminal of SLA/LP corresponding to a region with amino acids MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG |
Purity/Format | Affinity purified |
Blocking Peptide | SLA/LP Blocking Peptide |
Description | Rabbit polyclonal SLA/LP antibody raised against the N terminal of SLA/LP |
Gene | SEPSECS |
Supplier Page | Shop |