Name | KIAA1333 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3092 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | KIAA1333 antibody was raised using the N terminal of KIAA1333 corresponding to a region with amino acids IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR |
Purity/Format | Affinity purified |
Blocking Peptide | KIAA1333 Blocking Peptide |
Description | Rabbit polyclonal KIAA1333 antibody raised against the N terminal of KIAA1333 |
Gene | G2E3 |
Supplier Page | Shop |