| Name | LARP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4917 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LARP1 antibody was raised using the N terminal of LARP1 corresponding to a region with amino acids HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN |
| Purity/Format | Affinity purified |
| Blocking Peptide | LARP1 Blocking Peptide |
| Description | Rabbit polyclonal LARP1 antibody raised against the N terminal of LARP1 |
| Gene | LARP1 |
| Supplier Page | Shop |