| Name | LRRC26 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6595 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | LRRC26 antibody was raised using the middle region of Lrrc26 corresponding to a region with amino acids LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC26 Blocking Peptide |
| Description | Rabbit polyclonal LRRC26 antibody raised against the middle region of Lrrc26 |
| Gene | LRRC26 |
| Supplier Page | Shop |