Name | MYH9 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2739 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | MYH9 antibody was raised using the middle region of MYH9 corresponding to a region with amino acids DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK |
Purity/Format | Affinity purified |
Blocking Peptide | MYH9 Blocking Peptide |
Description | Rabbit polyclonal MYH9 antibody raised against the middle region of MYH9 |
Gene | MYH9 |
Supplier Page | Shop |