EVI1 antibody

Name EVI1 antibody
Supplier Fitzgerald
Catalog 70R-4757
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen EVI1 antibody was raised using the middle region of EVI1 corresponding to a region with amino acids KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT
Purity/Format Affinity purified
Blocking Peptide EVI1 Blocking Peptide
Description Rabbit polyclonal EVI1 antibody raised against the middle region of EVI1
Gene RUNX1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.