| Name | TNRC6B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4949 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TNRC6B antibody was raised using the N terminal of TNRC6B corresponding to a region with amino acids YVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAV |
| Purity/Format | Affinity purified |
| Blocking Peptide | TNRC6B Blocking Peptide |
| Description | Rabbit polyclonal TNRC6B antibody raised against the N terminal of TNRC6B |
| Gene | TNRC6B |
| Supplier Page | Shop |