Name | HNF4A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2034 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | HNF4A antibody was raised using the middle region of HNF4A corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI |
Purity/Format | Affinity purified |
Blocking Peptide | HNF4A Blocking Peptide |
Description | Rabbit polyclonal HNF4A antibody raised against the middle region of HNF4A |
Gene | HNF4A |
Supplier Page | Shop |