| Name | PLUNC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5913 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL |
| Purity/Format | Affinity purified |
| Blocking Peptide | PLUNC Blocking Peptide |
| Description | Rabbit polyclonal PLUNC antibody raised against the middle region of PLUNC |
| Gene | BPIFA1 |
| Supplier Page | Shop |