| Name | CHST7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1906 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | CHST7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CHST7 Blocking Peptide |
| Description | Rabbit polyclonal CHST7 antibody |
| Gene | CHST7 |
| Supplier Page | Shop |