Name | CHST7 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1906 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Dog |
Antigen | CHST7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | CHST7 Blocking Peptide |
Description | Rabbit polyclonal CHST7 antibody |
Gene | CHST7 |
Supplier Page | Shop |